PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G18270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 319aa    MW: 36318.5 Da    PI: 7.4628
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G18270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.94.9e-27116166151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krien++nrqvtfskRr+gilKKA E+ vLCdaev v+ifss gkl +y++
  ORUFI05G18270.1 116 KRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVGVVIFSSAGKLSDYCT 166
                      79***********************************************96 PP

2K-box58.13.7e-20178276197
            K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqR..hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                      yq++sgk l+++k++sl+ e++++kke++n+q e+R  h++GedL+sL+ keL  +e++L+++  + R+k +++++++ ++ ++ e+e++    
  ORUFI05G18270.1 178 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRlvHMKGEDLNSLQPKELIAIEEALNNGQANLRDKMMDHWRMHKRNEKMLEDEHKMLAF 271
                      79999999************************998888********************************998888888888888888777766 PP

            K-box  93 aLrkk 97 
                      + +++
  ORUFI05G18270.1 272 RVHQQ 276
                      66665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.469108168IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-39108167IPR002100Transcription factor, MADS-box
CDDcd002652.74E-41109187No hitNo description
SuperFamilySSF554557.98E-32109202IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-27110130IPR002100Transcription factor, MADS-box
PfamPF003195.3E-23117164IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-27130145IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-27145166IPR002100Transcription factor, MADS-box
PfamPF014867.9E-13189273IPR002487Transcription factor, K-box
PROSITE profilePS5129711.788191279IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MAQCTTRERE RERERAVSIS GAPALPHRES PPHLHSFHGG LPPPPPPLHP PLLLHSNHGV  60
QSSTPPTIPT LKTGRTATPQ PSCFFESEVK ICFLVCVLGV EEEEELDMGR GKIEIKRIEN  120
STNRQVTFSK RRAGILKKAR EIGVLCDAEV GVVIFSSAGK LSDYCTPKTT LSRILEKYQT  180
NSGKILWDEK HKSLSAEIDR VKKENDNMQI ELRLVHMKGE DLNSLQPKEL IAIEEALNNG  240
QANLRDKMMD HWRMHKRNEK MLEDEHKMLA FRVHQQEVEL SGGIRELELG YHHDDRDFAA  300
SMPFTFRVQP SHPNLQQEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-17108193178Myocyte-specific enhancer factor 2B
1tqe_Q5e-17108193178Myocyte-specific enhancer factor 2B
1tqe_R5e-17108193178Myocyte-specific enhancer factor 2B
1tqe_S5e-17108193178Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankRICOSMAA0.0L37527.1 Oryza sativa MADS box protein (MADS4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640709.11e-153PREDICTED: MADS-box transcription factor 4 isoform X1
SwissprotQ407031e-152MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLA0A0E0PMQ20.0A0A0E0PMQ2_ORYRU; Uncharacterized protein
STRINGBGIOSGA019900-PA1e-153(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.17e-71MIKC_MADS family protein